PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G023600.1
Common NamePHAVU_007G023600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 241aa    MW: 27160.1 Da    PI: 6.4239
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G023600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445.2e-14123167347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
  Phvul.007G023600.1 123 PWTEEEHRLFLIGLSKFGKGDWRSISRNVVVTRTPTQVASHAQKY 167
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.9821266IPR017877Myb-like domain
SuperFamilySSF466896.43E-91465IPR009057Homeodomain-like
SMARTSM007170.241668IPR001005SANT/Myb domain
CDDcd001670.002211962No hitNo description
PROSITE profilePS5129420.521116172IPR017930Myb domain
SuperFamilySSF466896.68E-17118172IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-17119171IPR006447Myb domain, plants
SMARTSM007177.3E-11120170IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-11120166IPR009057Homeodomain-like
CDDcd001677.94E-10123168No hitNo description
PfamPF002496.6E-12123167IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MFHESSVTRW QTQPVQPTEW TRYHDKLFER ALLLVPEDLP DRWNQIAGHV PGMSPAEVRE  60
HYDALVHDVF EIDSGRVEVP SYVDDSAPQL SGGAGNSAWD SANQISFGSK PKQGDSERKK  120
GTPWTEEEHR LFLIGLSKFG KGDWRSISRN VVVTRTPTQV ASHAQKYFLR QNSGKKERKR  180
SSIHDITTVD SNSVPVPIDQ NWVPPPGASM QQSQDMLQYP SSNMHDQMGP FGYSSYGFEM  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A9e-1420821173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007142868.11e-180hypothetical protein PHAVU_007G023600g
SwissprotQ8S9H72e-62DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLV7BAF71e-180V7BAF7_PHAVU; Uncharacterized protein
STRINGGLYMA20G24600.11e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-80MYB family protein